Table 1.

Proteins containing cell wall sorting signals

SourceSequence of C-terminal sorting signalaReference(s)
Actinomyces naeslundii
 Fim P: type 1 fimbrial subunit (T14V)LPLTGANGVIFLTIAGALLVAGGAVVAYANKRRHVAKH868
 Fim A: type 1 fimbrial subunit (T14V)LPLTGANGMLILTASGASLLMIAVGSVLVARYRERKQNANLAL869
 Type 2 fimbrial subunit (WVU45)LPLTGANGMLILTASGAALLMIAVGSVLVARYRERKRNRDLAA867
Enterococcus faecalis
 Asa1: aggregation substanceLPQTGEKQNVLLTVAGSLAAMLGLAGLGFKRRKETK237
 Asc10: aggregation substanceLPKTGEKQNVLLTVVGSLAAMLGLAGLGFKRRKETK411
 Asp1: aggregation substanceLPHTGEKENTLLSVLGAGMLAGLAWFGLKRKETEK236
 Sea1: surface exclusion proteinLPHTGEQKSIWLTIFGLFMAVGAISFKNKRRKNS840
 Sec10: surface exclusion proteinLPQTGEQQSIWLTIIGLLMAAGTINFKNKKRKKNS411
 PrgC: phermone-responsive surface proteinLPHTGEKFTLLFSVLGSFFVLISGFFFFKKNKKKA411, 571
 Unknown ORFb (hypothetical 30.5 kDa)LPKTGETENIALSVLGSLMVLGSAFIFKKRI771
Enterococcus faecium
 Ash701: aggregation substanceLPQTGEKQNILLTVAGSLVTMLGLAGVGLKRRKETK315
Lactococcus lactis
 CluA: sex factor aggregation proteinLPKTGEGKAALAISIFGAALLGLAAYLKRNWIVSTYRKTVRKIRK271
 NisP: nisin serine proteaseLPVTGDGEDFLPALGIVCISILGILKRKTKN810
 PrtP: casein serine proteaseLPKTGETTERPAFGFLGVIVVSLMGVLGLKRKQREE820
Lactobacillus paracasei
 PrtP: casein serine proteaseLPKTAETTERPAFGFLGVIVSLMGVLGLKRKQREE343
Listeria monocytogenes
 Internalin ALPTTGDSDNALYLLLGLLAVGTAMALTKKARASK235
 Internalin C2LPTAGDENTMLPIFIGVFLLGTATLILRKTIKVK162
 Internalin DLPTAGDENTMLPIFIGVFLLGTATLILRKTIKVK162
 Internalin ELPITGDELNVLPIFVGAVLIGIGLVLFRKKRQTK162
 Internalin FLPKTGDNAPWKTLFAGILLSSSAFYIWRKKA162
Peptostreptococcus magnus
 Protein LLPKAGSEAEILTLAAAALSTAAGAYVSLKKRK412, 567
 PABLPEAGRRKAEILTLAAASLSSVAGAFISLKKRK141
Streptococcus pyogenes (GAS)
 C5A peptidaseLPTTNDKDTNRLHLLKLVMTTFFFGLVAHIFKTKRQKETKK118
 Trypsin-resistant surface protein (T6)LPSTGSIGTYLFKAIGSAAMIGAIGIYIVKRRKA714
 SfbI/protein FLPATGDIENVLAFLGILILSVLSIFSLLKNKQSNKKV720, 778
 SfbII/OFLPASGDKREASFTIVALTIIGAAGLLSKKRRDTEEN448, 658
 M protein
  Class I Emm (M6)LPSTGETANPFFTAAALTVMATAGVAAVVKRKEENTable 2
  Class II Emm (Emm22)LPSTGEAANPFFTAAAATVMVSAGMLALKRKEENTable 2
  Mrp/FcrA (Mrp8)LPSTGEETTNPFFTAAALTVIASAGVLALKRKEENTable 2
  Enn (Enn49)LPSTGEAANPFFTAAAATVMVSAGMLALKRKEENTable 2
  Unknown ORFLPSTGEKAQPLFLATMTLMSLLGSLLVTKRQKETKK639
Streptococcus agalactiae (GBS)
 Alpha antigenLPATGENATPFFNVAALTIISSVGLLSVSKKKED550
 Rib proteinLPATGENATPFFNVVALTIMSSVGLLSVSKKKED837
 Beta antigen (IgA Fc receptor)LPYTGVASNLVLEIMGLLGLIGTSFIAMKRRKS319, 382
 C5a peptidaseLPTTNDKDTNRLHLLKLVMTTFFLGLVAHIFKTKRQKETKK119
Streptococcus sp. (GCS and GGS)
 Protein G (IgG binding)LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED194, 290
 M protein (Group C)LPSTGEATNPFFTAAALAVMATAGVAAVVKRKEEN776
 MIG (strain SC1)LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED401
 MAG (strain 8215)LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED399
 FnBA: fibronectin binding proteinLPQTGDTNKLETFFTITALTVIGAAGLLGKKRRNNQTD490
 FnBB: fibronectin binding proteinLPAAGEAEHVLSTIVGAMILFLVSLWGLLKRKASKA490
 GfbA: fibronectin binding proteinLPATGDIENVLAFLGILILSVLPIFSLLKNKQNNKV430
Streptococcus gordonii
 SspA/SSP-5 (antigen I/II)LPKTGTNDSSYMPYLGLAALVGVLGLGQLKRKEDESK149
 SspB (antigen I/II)LPKTGTNDATYMPYLGLAALVGFLGLGLAKRKED148, 149
 CshALPRTGSQTSDQTASGLLAAIASLTFFGLANRKKKSKED538, 539
Streptococcus mutans
 Antigen I/II (P1, B, PAc)LPNTGVTNNAYMPLLGIIGLVTSFSLLGLKAKKD422, 423, 598
 β-d-FructosidaseLPDTGDHKTDLSQLGVLAMIGSFLVEIASYFKKSKD103
 DextranaseLPQTGDNNETRSNLLKVIGAGALLIGAAGLLSLIKGRKND363
 Glucan binding protein CLPHTGAAKQNGLATLGAISTAFAAATLIAARKKEN704
 WapALPSTGEQAGLLLTTVGLVIVAVAGVYFYRTRR201
Streptococcus pneumoniae
 β- N -AcetylhexoseaminidaseLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED122
 NeuraminidaseLPETGNKESDLLASLGLTAFFLGLFTLGKKREQ107
Streptococcus sobrinus/downeii
 SPAA (antigen I/II; PAg)LPATGDSSNAYLPLLGLVSLTAGFSLLGLRRKQD794
 DextranaseLPKTGDHKTVVLIIVLGLVFVGMTGLLARHEKK827
Streptococcus equi
 ZAGLPTTGEKANPFFTAAALAIMAGAGALAVTSKRQQD400
 Fibronectin binding proteinLPQTSDMKQLTLSIIGAMSMLLVLCLSLFKRPSKKD491, 492
 SeMLPSTGESANPFFTIAALTVIAGAGMAVVSPKRKEN784
 SzPW60LPSTGEATNPFFTAAALAVMAGAGVAAVSTRRKEN785
 SzPSeLPSTGEATNPFFTAAALAVMAGAGVAAVSTRRKEN784
Streptococcus suis
 136-kDa muramidase released surface proteinLPNTGEASSVAGALGTAMLVATLAFARKRRRNED747
Staphylococcus aureus
 Collagen adhesinLPKTGMKIITSWITWVFIGILGLYLILRKRFNS626
 Fibrinogen binding protein (clumping factor)LPDTGSEDEANTSLIWGLLASIGSLLLFRRKKENKDKK531
 FNBP: fibronectin binding proteinLPETGGEESTNKGMLFGGLFSILGLALLRRNKKNHKA727
 Protein A: IgG binding proteinLPETGEENPFIGTTVFGGLSLALGAALLAGRRREL726, 803
Staphylococcus epidermidis
 Fibrinogen binding proteinLPDTGANEDYGSKGTLLGTLFAGLGALLLGKRRKNRKNKN590
  • a The LPXTG motif is shown in boldface type.

  • b ORF, open reading frame.