Table 1.

Proteins containing cell wall sorting signals

SourceSequence of C-terminal sorting signalaReference(s)
Actinomyces naeslundii
 Fim P: type 1 fimbrial subunit (T14V) LPLTGANGVIFLTIAGALLVAGGAVVAYANKRRHVAKH 868
 Fim A: type 1 fimbrial subunit (T14V) LPLTGANGMLILTASGASLLMIAVGSVLVARYRERKQNANLAL 869
 Type 2 fimbrial subunit (WVU45) LPLTGANGMLILTASGAALLMIAVGSVLVARYRERKRNRDLAA 867
Enterococcus faecalis
 Asa1: aggregation substance LPQTGEKQNVLLTVAGSLAAMLGLAGLGFKRRKETK 237
 Asc10: aggregation substance LPKTGEKQNVLLTVVGSLAAMLGLAGLGFKRRKETK 411
 Asp1: aggregation substance LPHTGEKENTLLSVLGAGMLAGLAWFGLKRKETEK 236
 Sea1: surface exclusion protein LPHTGEQKSIWLTIFGLFMAVGAISFKNKRRKNS 840
 Sec10: surface exclusion protein LPQTGEQQSIWLTIIGLLMAAGTINFKNKKRKKNS 411
 PrgC: phermone-responsive surface protein LPHTGEKFTLLFSVLGSFFVLISGFFFFKKNKKKA 411,571
 Unknown ORFb (hypothetical 30.5 kDa) LPKTGETENIALSVLGSLMVLGSAFIFKKRI 771
Enterococcus faecium
 Ash701: aggregation substance LPQTGEKQNILLTVAGSLVTMLGLAGVGLKRRKETK 315
Lactococcus lactis
 CluA: sex factor aggregation protein LPKTGEGKAALAISIFGAALLGLAAYLKRNWIVSTYRKTVRKIRK 271
 NisP: nisin serine protease LPVTGDGEDFLPALGIVCISILGILKRKTKN 810
 PrtP: casein serine protease LPKTGETTERPAFGFLGVIVVSLMGVLGLKRKQREE 820
Lactobacillus paracasei
 PrtP: casein serine protease LPKTAETTERPAFGFLGVIVSLMGVLGLKRKQREE 343
Listeria monocytogenes
 Internalin A LPTTGDSDNALYLLLGLLAVGTAMALTKKARASK 235
 Internalin C2 LPTAGDENTMLPIFIGVFLLGTATLILRKTIKVK 162
 Internalin D LPTAGDENTMLPIFIGVFLLGTATLILRKTIKVK 162
 Internalin E LPITGDELNVLPIFVGAVLIGIGLVLFRKKRQTK 162
 Internalin F LPKTGDNAPWKTLFAGILLSSSAFYIWRKKA 162
Peptostreptococcus magnus
 Protein L LPKAGSEAEILTLAAAALSTAAGAYVSLKKRK 412,567
 PAB LPEAGRRKAEILTLAAASLSSVAGAFISLKKRK 141
Streptococcus pyogenes (GAS)
 C5A peptidase LPTTNDKDTNRLHLLKLVMTTFFFGLVAHIFKTKRQKETKK 118
 Trypsin-resistant surface protein (T6) LPSTGSIGTYLFKAIGSAAMIGAIGIYIVKRRKA 714
 SfbI/protein F LPATGDIENVLAFLGILILSVLSIFSLLKNKQSNKKV 720,778
 SfbII/OF LPASGDKREASFTIVALTIIGAAGLLSKKRRDTEEN 448,658
 M protein
  Class I Emm (M6) LPSTGETANPFFTAAALTVMATAGVAAVVKRKEENTable 2
  Class II Emm (Emm22) LPSTGEAANPFFTAAAATVMVSAGMLALKRKEENTable 2
  Mrp/FcrA (Mrp8) LPSTGEETTNPFFTAAALTVIASAGVLALKRKEENTable 2
  Enn (Enn49) LPSTGEAANPFFTAAAATVMVSAGMLALKRKEENTable 2
  Unknown ORF LPSTGEKAQPLFLATMTLMSLLGSLLVTKRQKETKK 639
Streptococcus agalactiae (GBS)
 Alpha antigen LPATGENATPFFNVAALTIISSVGLLSVSKKKED 550
 Rib protein LPATGENATPFFNVVALTIMSSVGLLSVSKKKED 837
 Beta antigen (IgA Fc receptor) LPYTGVASNLVLEIMGLLGLIGTSFIAMKRRKS 319,382
 C5a peptidase LPTTNDKDTNRLHLLKLVMTTFFLGLVAHIFKTKRQKETKK 119
Streptococcus sp. (GCS and GGS)
 Protein G (IgG binding) LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED 194,290
 M protein (Group C) LPSTGEATNPFFTAAALAVMATAGVAAVVKRKEEN 776
 MIG (strain SC1) LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED 401
 MAG (strain 8215) LPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED 399
 FnBA: fibronectin binding protein LPQTGDTNKLETFFTITALTVIGAAGLLGKKRRNNQTD 490
 FnBB: fibronectin binding protein LPAAGEAEHVLSTIVGAMILFLVSLWGLLKRKASKA 490
 GfbA: fibronectin binding protein LPATGDIENVLAFLGILILSVLPIFSLLKNKQNNKV 430
Streptococcus gordonii
 SspA/SSP-5 (antigen I/II) LPKTGTNDSSYMPYLGLAALVGVLGLGQLKRKEDESK 149
 SspB (antigen I/II) LPKTGTNDATYMPYLGLAALVGFLGLGLAKRKED 148,149
 CshA LPRTGSQTSDQTASGLLAAIASLTFFGLANRKKKSKED 538,539
Streptococcus mutans
 Antigen I/II (P1, B, PAc) LPNTGVTNNAYMPLLGIIGLVTSFSLLGLKAKKD 422,423, 598
 β-d-Fructosidase LPDTGDHKTDLSQLGVLAMIGSFLVEIASYFKKSKD 103
 Dextranase LPQTGDNNETRSNLLKVIGAGALLIGAAGLLSLIKGRKND 363
 Glucan binding protein C LPHTGAAKQNGLATLGAISTAFAAATLIAARKKEN 704
 WapA LPSTGEQAGLLLTTVGLVIVAVAGVYFYRTRR 201
Streptococcus pneumoniae
 β- N -Acetylhexoseaminidase LPETGTHDSAGLVVAGLMSTLAAYGLTKRKED 122
 Neuraminidase LPETGNKESDLLASLGLTAFFLGLFTLGKKREQ 107
Streptococcus sobrinus/downeii
 SPAA (antigen I/II; PAg) LPATGDSSNAYLPLLGLVSLTAGFSLLGLRRKQD 794
 Dextranase LPKTGDHKTVVLIIVLGLVFVGMTGLLARHEKK 827
Streptococcus equi
 ZAG LPTTGEKANPFFTAAALAIMAGAGALAVTSKRQQD 400
 Fibronectin binding protein LPQTSDMKQLTLSIIGAMSMLLVLCLSLFKRPSKKD 491,492
 SeM LPSTGESANPFFTIAALTVIAGAGMAVVSPKRKEN 784
 SzPW60 LPSTGEATNPFFTAAALAVMAGAGVAAVSTRRKEN 785
 SzPSe LPSTGEATNPFFTAAALAVMAGAGVAAVSTRRKEN 784
Streptococcus suis
 136-kDa muramidase released surface protein LPNTGEASSVAGALGTAMLVATLAFARKRRRNED 747
Staphylococcus aureus
 Collagen adhesin LPKTGMKIITSWITWVFIGILGLYLILRKRFNS 626
 Fibrinogen binding protein (clumping factor) LPDTGSEDEANTSLIWGLLASIGSLLLFRRKKENKDKK 531
 FNBP: fibronectin binding protein LPETGGEESTNKGMLFGGLFSILGLALLRRNKKNHKA 727
 Protein A: IgG binding protein LPETGEENPFIGTTVFGGLSLALGAALLAGRRREL 726,803
Staphylococcus epidermidis
 Fibrinogen binding protein LPDTGANEDYGSKGTLLGTLFAGLGALLLGKRRKNRKNKN 590
  • a The LPXTG motif is shown in boldface type.

  • b ORF, open reading frame.